PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004514445.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 348aa    MW: 39006.3 Da    PI: 7.8456
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004514445.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071e-333690155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  XP_004514445.1 36 KPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 90
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-323391IPR009057Homeodomain-like
PROSITE profilePS5129412.8013393IPR017930Myb domain
SuperFamilySSF466891.7E-163591IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-233691IPR006447Myb domain, plants
PfamPF002492.5E-83888IPR001005SANT/Myb domain
PfamPF143791.6E-21129167IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MERMFPSKKP LTMNSSHERP MCVQGDSGLV LTTDPKPRLR WTVELHERFV DAVAQLGGPD  60
KATPKTIMRV MGVKGLTLYH LKSHLQKFRL GKQPHKEFNE QSVKDVSAFE LQRNTGTSSS  120
MTGRNMNEMQ MEVHRRLHEQ LEVQKHLQLR IEAQGKYMQS ILEKAYSTLA GENMAVSATN  180
FKGVIGTQGT PNLSIMKDFV SPLNYPPFQD LNICGSDDEQ LDLHHHIIER PTLDEMLMPN  240
NNENLFVGKK RPSPNFNGGS GKSPLIWNDN DLRLHDLGTA SSSISPQDVP NFKGDDESDI  300
IYDTKVGEKK FDASMKLGIS SPSRVTFQSE RMSPMINVVA GHSSSPFG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0526380.0BT052638.1 Medicago truncatula clone MTYFD_FE_FF_FG1G-O-4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004514445.10.0PREDICTED: myb family transcription factor APL-like isoform X2
SwissprotQ9SAK51e-114APL_ARATH; Myb family transcription factor APL
TrEMBLB7FKL90.0B7FKL9_MEDTR; Putative uncharacterized protein
STRINGGLYMA15G29620.11e-159(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-115G2-like family protein